PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009797878.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 552aa    MW: 62757.2 Da    PI: 6.3971
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009797878.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS301.12.7e-921815502374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalkl.fsevsPilkfs 94 
                      + Ll++Ae vs+++  +a+++L++ + las++g+p qR+++yf++AL++r+ r++ +l+ + ++ et+ +   ++++ a +l f++  P+ ++ 
  XP_009797878.1 181 AQILLAAAEKVSDQQYDRARKMLSQCQPLASNTGNPAQRAVFYFAQALEERIDRETGRLMPKTHSVETDGSIcIASRFDASHLaFHQEVPFTQVV 275
                     689***************************************************766666666555555443666666666667*********** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrled 188
                     h+t  qaIle+v+++ +vH +Df i  G+QW++L+qa a+R+ +++ +++iT+++s   ++ke++eetg+ L++fA++l+ p++f+++   + ++
  XP_009797878.1 276 HFTGIQAILESVATKPKVHLVDFLIRTGVQWASLIQAAAERKdNPSEHMKITVIES---VNKERVEETGKSLESFAKSLNFPLSFKIVFLPDRNQ 367
                     *****************************************966677*********...78**************************9999**** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     l+ ++++vkp+E +++  ++ l  +  e+ +le      +++v++l+P+++vv+e ea+ ns+ F++rf+++l yysa+fd+le  + r++++r+
  XP_009797878.1 368 LTEDHFDVKPDEGVVIYAAFFLRAMICEPNCLET----AMRVVRRLQPELMVVSEVEANQNSPMFVNRFIDSLFYYSAFFDCLEDVMKRDDQHRM 458
                     **************************88888888....********************************************************* PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++E +  gr i+n+v  eg+er+ r  +l  Wr+ l+++G+++v+lse+   qa+l++++++  +  + + +  sl+  Wk+ p++ +SaW+
  XP_009797878.1 459 TLESVTYGRGIRNIVGSEGKERVCRSVNLDVWRSFLKRFGMEEVKLSETCLYQANLIIQQFAcRNSCTADINGRSLIVSWKGTPIYITSAWK 550
                     **************************************************************888899999999*****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.16154529IPR005202Transcription factor GRAS
PfamPF035149.5E-90181550IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MANPLSHLAS FTSNQISGSD HSLIVCREDI AKSYNQLSVM EDSTDIQNFC TNYGFYQDYA  60
VNPQVQEMNK QQEEMNVYAV TPQVQTGSHV DKSHFSSLGP FELLRNNPSR CKNTEGDKIR  120
NMNDRANAYQ KLSAMQIMKL AGERFIQFSS NKFININNLL HPYGSALSNL SPDDNQDVEL  180
AQILLAAAEK VSDQQYDRAR KMLSQCQPLA SNTGNPAQRA VFYFAQALEE RIDRETGRLM  240
PKTHSVETDG SICIASRFDA SHLAFHQEVP FTQVVHFTGI QAILESVATK PKVHLVDFLI  300
RTGVQWASLI QAAAERKDNP SEHMKITVIE SVNKERVEET GKSLESFAKS LNFPLSFKIV  360
FLPDRNQLTE DHFDVKPDEG VVIYAAFFLR AMICEPNCLE TAMRVVRRLQ PELMVVSEVE  420
ANQNSPMFVN RFIDSLFYYS AFFDCLEDVM KRDDQHRMTL ESVTYGRGIR NIVGSEGKER  480
VCRSVNLDVW RSFLKRFGME EVKLSETCLY QANLIIQQFA CRNSCTADIN GRSLIVSWKG  540
TPIYITSAWK FH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-4420355026375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009797878.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM1DFW30.0M1DFW3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000884000.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA139101114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-57RGA-like 2